SLP-76/LCP2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87032PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87032PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all SLP-76/LCP2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LCP2.

Source: E. coli

Amino Acid Sequence: PNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87032.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87032PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SLP-76/LCP2

SLP76 (SH2 domain containing leukocyte protein of 76 kDa) is a hematopoietic cell-specific adaptor protein that is crucial for T-cell receptor (TCR) signaling, hemostasis and platelet function. TCR ligation and fibrinogen binding to integrin alpha 2 beta 3 stimulates the phosphorylation of the tyrosine residues in the amino terminus, and facilitates SLP76 binding to the SH2 domain of Vav, which can activate JNK. SLP76 also comprises a proline-rich domain region that associates with the SH3 domain of Grb2 linking SLP76 to the Ras to Raf to ERK1 & 2 signaling pathway, LAT, PLC gamma, Fyn-binding protein (SLAP130), the SH2 containing phosphatase 1 and Nck, which mediates the regulation of cytoskeletal actin polymerization. Phosphorylation of tyrosine 145 has been shown to be important for optimal SLP76 function.

Long Name

SH2 Domain-containing Leukocyte Protein of 76 kDa

Alternate Names

LCP2, SLP76

Gene Symbol

LCP2

Additional SLP-76/LCP2 Products

Product Documents for SLP-76/LCP2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLP-76/LCP2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.