SOAT1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32052PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32052PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all SOAT1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOAT1.

Source: E. coli

Amino Acid Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32052.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32052PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SOAT1

Acely-CoA:cholestorl acyltransferase (ACAT) is an integral membrane enzyme that belongs to type-B carboxylesterase/lipase family. ACAT catalyzes the formation of cholesteryl esters from cholesterol and long-chain fatty-acyl-coenzyme A (1). ACAT also function as a regulator of intracellular cholesterol homeostasis at single cell level. Two isoform of ACAT exists, ACAT1 and ACAT2, are expressed in liver and intestine. However, ACAT1 is only found in macrophages and SMCs (2). The accumulation of cholesteryl esters produced by ACAT in macrophages can lead to foam cell formation, an indication of early stage atherosclerosis. ACAT activity has been linked to Alzehimer's Diease, condition caused by excess amount of amyloid beta-peptide (Abeta). Atherogenic lipoproteins activate ACAT activity, where active ACAT can modulate the level of Abeta (3).

Long Name

Sterol O-Acyltransferase 1

Alternate Names

ACACT, ACAT-1, EC 2.3.1.26, SOAT1

Gene Symbol

SOAT1

Additional SOAT1 Products

Product Documents for SOAT1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SOAT1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.