SR-BI Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-62676PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCARB1.
Source: E. coli
Amino Acid Sequence: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62676.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking tide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-62676PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: SR-BI
At least 5 different human splice variants have been identified with theoretical molecular weights ranging from 60.9 kDa for the canonical sequence to 45 kDa for an N-terminally truncated variant (SR-BII) (3). The extracellular domain of human SR-BI (CLA-1) shares 80%, 80%, 89%, 86% and 84% aa sequence identity with mouse, rat, porcine, rabbit, and bovine SR-BI, respectively. SR-BI is highly glycosylated and removal of N-linked glycosylation reduces lipid transport.
References
1. Linton MF, Tao H, Linton EF, Yancey PG. (2017) SR-BI: A Multifunctional Receptor in Cholesterol Homeostasis and Atherosclerosis. Trends Endocrinol Metab. 28(6):461-472. PMID: 28259375
2. Hoekstra M, Sorci-Thomas M. (2017) Rediscovering scavenger receptor type BI: surprising new roles for the HDL receptor. Curr Opin Lipidol. 28(3):255-260. PMID: 28301373
3. Shen WJ, Asthana S, Kraemer FB, Azhar S. (2018) Scavenger receptor B type 1: expression, molecular regulation, and cholesterol transport function.
Long Name
Scavenger Receptor Class B, Member I
Alternate Names
CD36L1, CLA1, HDLQTL6, SCARB1, SR-B1, SRBI
Gene Symbol
SCARB1
Additional SR-BI Products
Product Documents for SR-BI Recombinant Protein Antigen
Product Specific Notices for SR-BI Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...