STK32A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82735PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82735PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all STK32A Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK32A.

Source: E. coli

Amino Acid Sequence: HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82735.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82735PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: STK32A

Sprouty was originally identified as an inhibitor of Drosophila epidermal growth factor (EGF) and fibroblast growth factor (FGF) receptor signaling during tracheal development. Four isoforms of mammalian sprouty are known (Spry1-Spry4). The role of the mammalian analogs has not been clearly elucidated although it is believed that human Sprouty 2 (hSpry2) may be an inhibitor of cellular migration and proliferation. Spry2 and Spry4 show considerable sequence homology between human and mouse at the C terminus of the protein. Significant sequence divergence occurs at the N terminus. Spry2 appears to be abundant in brain, lung and heart tissue, with lesser amounts found in kidney and skeletal muscle.

Alternate Names

A930015B13Rik, EC 2.7.11, EC 2.7.11.1, MGC22688, serine/threonine kinase 32A, YANK1serine/threonine-protein kinase 32A

Gene Symbol

STK32A

Additional STK32A Products

Product Documents for STK32A Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for STK32A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.