STK39 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49373PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK39.
Source: E. coli
Amino Acid Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49373.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking tide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-49373PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: STK39
Alternate Names
DCHTsmall intestine SPAK-like kinase, DKFZp686K05124, EC 2.7.11, EC 2.7.11.1, PASK, proline-alanine-rich STE20-related kinase, serine threonine kinase 39, Serine/threonine-protein kinase 39, SPAKserine threonine kinase 39 (STE20/SPS1 homolog, yeast), STE20/SPS1 homolog, STE20/SPS1-related proline-alanine-rich protein kinase, Ste20-like protein kinase, Ste-20-related kinase
Gene Symbol
STK39
Additional STK39 Products
Product Documents for STK39 Recombinant Protein Antigen
Product Specific Notices for STK39 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...