SUMO-interacting Motif (SIM) Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55180PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55180PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all SUMO-interacting Motif (SIM) Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUMO-interacting Motif (SIM).

Source: E. coli

Amino Acid Sequence: YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55180.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55180PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SUMO-interacting Motif (SIM)

Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that are enzymatically attached to target proteins by a process termed SUMOylation. This post-translational modification regulates many cellular processes including DNA transcription and repair, cell cycle progression, protein intracellular trafficking, and nuclear receptor activities. SUMO binding and/or interaction with proteins is mediated by short amino acid consensus sequences termed SUMO-interacting motifs (SIMs). To date, all SIMs appear to contain a hydrophobic core sequence that is either preceded or succeeded by an acidic region composed of either glutamate or aspartate residues or phosphorylated serine or threonine residues. The hydrophobic core of SIMs has been shown to interact with the alpha-helix and beta2-strand surfaces on SUMO proteins while the negatively charged residues surrounding the hydrophobic core appear to influence binding affinities and dictate binding preferences for the various SUMO isoforms. SIMs have been identified in numerous types of proteins including SUMO ligases (E3), transcription factors, and transcriptional repressors.

Alternate Names

SUMOinteracting Motif

Gene Symbol

SIMC1

Additional SUMO-interacting Motif (SIM) Products

Product Documents for SUMO-interacting Motif (SIM) Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SUMO-interacting Motif (SIM) Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.