Skip to main content

Recombinant Human Synapsin I GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00006853-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00006853-Q01-25ug
H00006853-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_008881) for Human Synapsin I

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Synapsin I GST (N-Term) Protein

SDS-PAGE: Recombinant Human Synapsin I GST (N-Term) Protein [H00006853-Q01]

SDS-PAGE: Recombinant Human Synapsin I GST (N-Term) Protein [H00006853-Q01]

SDS-Page: Synapsin I Recombinant Protein [H00006853-Q01]

Formulation, Preparation and Storage

H00006853-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Synapsin I

Synapsin I is a neuron specific protein that is localized to nerve terminals. Synapsin Ia and Synapsin Ib are approximately 80,000 and 77,000 Daltons, respectively, and are collectively referred to as synapsin I. The synapsin protein is an excellent marker for synaptic terminals and it can be used to estimate synaptic density and or synaptogenesis. It is thought that synapsin I cross-links synaptic vesicles to the cytoskeleton and thereby limits the ability of these synaptic vesicles to move to active zones and fuse with the plasma membrane during exocytosis. In addition to their role in neurotransmission, the synapsins are also thought to play a role in synapse formation. The appearance of synapsin I immunoreactivity correlates precisely with the development of synapses in the CNS. The synapsin protein is an excellent marker for synaptic terminals and it can be used to estimate synaptic density and or synaptogenesis. The appearance of synapsin I was a precise indicator of synapse formation and that synapsin I immunocytochemistry provides a valuable tool for the study of synaptogenesis.

Alternate Names

SYN1

Gene Symbol

SYN1

Additional Synapsin I Products

Product Documents for Recombinant Human Synapsin I GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Synapsin I GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...