Skip to main content

Tensin 1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84129PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84129PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNS1.

Source: E. coli

Amino Acid Sequence: EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84129.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84129PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Tensin 1

Tensin 1 (TNS1, human Tensin 1 theoretical molecular weight 186kDa) belongs to a family of focal adhesion proteins which in mammals includes three other members: Tensin 2, Tensin 3, and C-terminal tensin-like (Cten or Tensin 4) (1, 2). Tensins localize to focal adhesion sites, which are functional domains of the cellular membrane that mediate interactions between the actin cytoskeleton and the extracellular matrix (1). Transmembrane integrin receptors (alpha-beta heterodimer) predominate within focal adhesions and serve to bridge the interactions between extracellular components and the cytoskeleton (3). Tensin 1 interacts with both actin filaments and beta-integrin receptors within focal adhesion sites to mediate cellular responses to extracellular signals (1, 4). Several common functional domains are shared between some tensin family members including: 1) amino terminal PTEN-related tyrosine phosphatase (PTP) domain, 2) amino terminal actin-binding (ABD-1) domain, 3) amino terminal focal adhesion binding (FAB-N) domain, 4) carboxy terminal Src homology 2 (SH2) domain, 5) carboxy terminal phosphotyrosine binding (PTB) domain, and 6) carboxy terminal focal adhesion binding (FAB-C) domain (4). The PTB domain allows tensins to interact with beta-integrin cytoplasmic tails, while their SH2 domain supports interaction with tyrosine-phosphorylated signaling proteins (1). The interactions of tensins with focal adhesion kinases and phosphatases support diverse cellular processes such as attachment, migration, and polarization. Loss of function studies have revealed that tensin 1 plays a critical role for normal kidney function, skeletal muscle regeneration and angiogenesis (1).

References

1. Lo, S. H. (2017). Tensins. Current Biology. https://doi.org/10.1016/j.cub.2017.02.041

2. Lo, S. H. (2014). C-terminal tensin-like (CTEN): A promising biomarker and target for cancer. International Journal of Biochemistry and Cell Biology. https://doi.org/10.1016/j.biocel.2014.04.003

3. Armitage, S. K., & Plotnikov, S. V. (2016). Bridging the gap: A new study reveals that a protein called talin forms a vital link between microtubules and focal adhesions at the surface of cells. ELife. https://doi.org/10.7554/eLife.19733

4. Lo, S. H. (2006). Focal adhesions: What's new inside. Developmental Biology. https://doi.org/10.1016/j.ydbio.2006.03.029

Alternate Names

DKFZp586K0617, matrix-remodelling associated 6, Matrix-remodelling-associated protein 6, MGC88584, MST091, MST122, MST127, MSTP127, MXRA6, tensin, tensin 1, tensin-1, TNSMSTP122

Gene Symbol

TNS1

Additional Tensin 1 Products

Product Documents for Tensin 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Tensin 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...