Recombinant Human TFII-I GST (N-Term) Protein

Name: Recombinant Human TFII-I GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002969-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00002969-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all TFII-I Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-239 of Human GTF2I

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

52.03 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TFII-I GST (N-Term) Protein

SDS-PAGE: Recombinant Human TFII-I GST (N-Term) Protein [H00002969-P01]

SDS-Page: Recombinant Human TFII-I Protein [H00002969-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002969-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: TFII-I

This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

BAP-135,135kD, BAP135WBS, Bruton tyrosine kinase-associated protein 135, BTKAP1, DIWS, FLJ38776, FLJ56355, general transcription factor II, i, general transcription factor IIi, general transcription factor II-I, GTFII-I, IB291, SPINBTK-associated protein 135, TFII-ISRF-Phox1-interacting protein, WBSCR6, Williams-Beuren syndrome chromosome region 6

Gene Symbol

GTF2I

Additional TFII-I Products

Product Documents for Recombinant Human TFII-I GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human TFII-I GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews