TRAIP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87125PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87125PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all TRAIP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAIP.

Source: E. coli

Amino Acid Sequence: QSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87125.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87125PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TRAIP

The TNF receptor-associated factor (TRAF) family is a group of cytoplasmic adapter proteins that link a wide variety of cell surface receptors including the TNF and IL-1 receptor (TRNFR and IL-1R) superfamily to diverse signaling cascades involved in differentiation, proliferation, activation and apoptosis. TRIP (TRAF-interacting protein) was identified in 1997 as a component of receptor-TRAF signaling complexes (Lee, 1997). TRIP (also known as TRAIP) has been shown to associate with TRNFR2 or CD30 signaling complexes through its interaction with TRAF proteins and inhibit TRAF2-mediated NF-kB activation (Lee, 1997; Regamey et al, 2003). The recruitment of different TRAFs and TRAF associated proteins like TRIP to receptor complexes can help regulate and provide specificity to the intracellular signals triggered by the cell surface receptors.

Alternate Names

RNF206TRIPRING finger protein 206, TRAF interacting protein, TRAF-interacting protein

Gene Symbol

TRAIP

Additional TRAIP Products

Product Documents for TRAIP Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRAIP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.