TRAP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47598PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-47598PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all TRAP1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAP1.

Source: E. coli

Amino Acid Sequence: RTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIREL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47598.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-47598PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TRAP1

The 90 kDa heat shock protein (hsp90) family of molecular chaperones is a highly conserved family of proteins that play an important physiological role. Hsp90 is involved in numerous cellular processes but is best known for its association with signal transduction machinery. A recently cloned homolog of hsp90 is TRAP1. Like hsp90, TRAP1 is found to be associated with numerous proteins involved in diverse actions. Immunofluorescence data has shown TRAP1 to be localized in the mitochondria of mammalian cells. This observation and the fact that TRAP1 is shown to have a mitochondrial targeting presequence strongly implicates TRAP1 as a mitochondrial matrix protein. Immunofluorescence staining of TRAP1 in PC-3-M cells with this antibody produces a pattern consistent with mitochondrial staining. Immunoprecipitation of TRAP1 using this antibody fails to co-precipitate p23, Hop, or CyP40 suggesting TRAP1®s inability to associate with these co-chaperones.

Alternate Names

HSP 75, HSP75TNFR-associated protein 1, HSP90Lheat shock protein 75 kDa, mitochondrial, TNF receptor-associated protein 1, TRAP-1, tumor necrosis factor type 1 receptor associated protein, Tumor necrosis factor type 1 receptor-associated protein

Gene Symbol

TRAP1

Additional TRAP1 Products

Product Documents for TRAP1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRAP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.