Recombinant Human TRIM59 GST (N-Term) Protein

Name: Recombinant Human TRIM59 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00286827-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00286827-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all TRIM59 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-403 of Human TRIM59

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

73.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TRIM59 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00286827-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: TRIM59

Tripartite Motif Containing 59 (human TRIM59 theoretical molecular weight 47 kDa) belongs to a large family of 80 human isoforms. TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signaling genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM59 is implicated in a variety of cancer types (e.g., breast, colorectal, ovarian, and esophageal) and its expression serves as a marker of poor prognosis in cancer patients (2,3). Originally cloned from mice and named mouse RING finger 1 (Mrf1), TRIM59 mRNA is predominantly expressed in testis, spleen, brain, and heart tissues (3). TRIMs play a role in the process of autophagy where they serve as receptors, regulatory proteins, and adaptors for core autophagy proteins (e.g., Beclin1, ULK1, and ATG16L1) (1).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Wang, M., Chao, C., Luo, G., Wang, B., Zhan, X., Di, D., Qian, Y., & Zhang, X. (2019). Prognostic significance of TRIM59 for cancer patient survival: A systematic review and meta-analysis. Medicine, 98(48), e18024. https://doi.org/10.1097/MD.0000000000018024

3. Mandell, M. A., Saha, B., & Thompson, T. A. (2020). The Tripartite Nexus: Autophagy, Cancer, and Tripartite Motif-Containing Protein Family Members. Frontiers in Pharmacology. https://doi.org/10.3389/fphar.2020.00308

4. Chang, R., Xu, X., & Li, M. D. (2002). Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1. Gene. https://doi.org/10.1016/S0378-1119(02)00603-0

Alternate Names

MGC129860, MGC129861, Mrf1, RING finger protein 104, RNF104MGC26631, TRIM57, tripartite motif containing 59, tripartite motif-containing 57, tripartite motif-containing 59, tripartite motif-containing protein 59, TSBF1MRF1, tumor suppressor TSBF1, Tumor suppressor TSBF-1

Gene Symbol

TRIM59

Additional TRIM59 Products

Product Documents for Recombinant Human TRIM59 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human TRIM59 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews