Recombinant Human TRPA1 GST (N-Term) Protein

Name: Recombinant Human TRPA1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00008989-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00008989-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all TRPA1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1033-1117 of Human TRPA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.09 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TRPA1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human TRPA1 GST (N-Term) Protein [H00008989-Q01]

SDS-Page: Recombinant Human TRPA1 Protein [H00008989-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00008989-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: TRPA1

Transient receptor potential ion channels (TRPCs) are a superfamily of six transmembrane segment-spanning, gated cation channels. TRPA1 is a TRP-related channel that responds to cold temperatures and pungent compounds and plays a role in both nociceptor and hair cell transduction. It is a transformation-associated gene product in lung epithelia, whereas its protein distribution is primarily restricted to sensory neurons. Blocking TRPA1 may be a therapeutic target for treating cold hyperalgesia caused by inflammation and nerve damage. It is now known that TRPA1 protein is also widely expressed outside of the CNS and is dys-regulated during oncogenic transformation.

Long Name

Transient receptor potential cation channel subfamily A member 1

Alternate Names

ANKTM1, Wasabi receptor

Gene Symbol

TRPA1

Additional TRPA1 Products

Product Documents for Recombinant Human TRPA1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human TRPA1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews