Tyrosine Hydroxylase Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21234PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tyrosine Hydroxylase
Source: E.coli
Amino Acid Sequence: EFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDEL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21234. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP3-21234PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Tyrosine Hydroxylase
Two transcription factor binding sites in the proximal region of the TH gene, the TPA-responsive element (TRE) and the c-AMP responsive element (CRE), have been implicated in the complex regulation of the TH gene. Dysregulation of breakdown for the amino acid, tyrosine, by TH is a result of a genetic disorder that results in Tyrosinemia (high levels of tyrosine in the blood, tissue and organs).
Tyrosine hydroxylase deficiency is a disorder that primarily affects movement, where individuals display symptoms that include lack of coordination when walking, postural tremors and unusual body positioning. TH deficient dopamine-responsive dystonia (DRD), also known as Segawa syndrome, is a rare genetic disorder that is associated with low levels of TH and is diagnosed during childhood with characteristic symptoms including increased muscle tone (dystonia) and signs of Parkinsonism like bradykinesia, tremors, rigidity and postural instability (2). Correspondingly, TH is also linked to Parkinson's disease in older adults, where low dopamine levels are a consistent neurochemical abnormality. Functional polymorphisms of the TH gene may be involved in the pathogenesis of neuropsychiatric diseases such as schizophrenia and other affective disorders where dopamine is often dysregulated (3).
References
1. Hamanaka, Y., & Mizunami, M. (2019). Tyrosine hydroxylase-immunoreactive neurons in the mushroom body of the field cricket, Gryllus bimaculatus. Cell Tissue Res, 376(1), 97-111. doi:10.1007/s00441-018-2969-9
2. Li, L., & Zhou, F. M. (2013). Parallel dopamine D1 receptor activity dependence of l-Dopa-induced normal movement and dyskinesia in mice. Neuroscience, 236, 66-76. doi:10.1016/j.neuroscience.2012.12.065
3. Borkar, C. D., Bharne, A. P., Nagalakshmi, B., Sakharkar, A. J., Subhedar, N. K., & Kokare, D. M. (2018). Cocaine- and Amphetamine-Regulated Transcript Peptide (CART) Alleviates MK-801-Induced Schizophrenic Dementia-Like Symptoms. Neuroscience, 375, 94-107. doi:10.1016/j.neuroscience.2018.01.056
Alternate Names
TH, TYH
Gene Symbol
TH
Additional Tyrosine Hydroxylase Products
Product Documents for Tyrosine Hydroxylase Recombinant Protein Antigen
Product Specific Notices for Tyrosine Hydroxylase Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...