YAP1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38430PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YAP1.
Source: E. coli
Amino Acid Sequence: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38430.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking peptide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-38430PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: YAP1
YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).
References
1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047
2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361
3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025
Long Name
Yes-associated Protein 1
Alternate Names
YAP2, YAP65, YKI, Yorkie Homolog
Gene Symbol
YAP1
Additional YAP1 Products
Product Documents for YAP1 Recombinant Protein Antigen
Product Specific Notices for YAP1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...