What is the advantage of NBP2-26245 over NBP2-29331? Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?

Name: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Brand: Novus Biologicals
SKU: NBP2-29331

While both of these peptides serve the same function, there are differences in the functional sequence. I would like to direct you to to two attached articles in regards to this. 1. NBP2-26245 (Piao, 2013), sequence is shown in Figure 3G, labelled as mTIRAP 2. NBP2-29331: (Shilling 2002), sequence is described under Reagents and Abs on page 5875. All things aside, we have extensive testing data for NBP2-26245 from in-house testing, whereas we are still in the process of validating NBP2-29331 in-house. We can offer much better support for NBP2-26245 so this is the product I would recommend.

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-29331

Submit a review

Citations (4)

Product Datasheet / COA / Protocols & Manuals

100% Guarantee

Product Summary
Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species

Human, Mouse

Product Summary for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4.

Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.

Product Specifications

Specificity

The TIRAP inhibitory peptide contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.

The control peptide consists of only the PTD sequence.

Application Notes

Inhibits TIRAP binding to TLR2 or TLR4.

Reactivity Notes

The inhibitor peptide sequence is from mouse and also reacts with human; there is only one amino acid difference between the mouse and human sequence

Inhibitor Content

TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.

Scientific Data Images for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Functional (Inhibition): TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-29331]

Functional (Inhibition): TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-29331] - TLR2/NF-kB/SEAPorter HEK 293 (NBP2-26274) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29331) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Pam3CSK4 (NBP2-25297) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).

Formulation, Preparation, and Storage

Preparation Method

Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. TIRAP Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS.
Add 54 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.

Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
- 8g of NaCl
- 0.2g of KCl
- 1.44g of Na2HPO4
- 0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving

Formulation

Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).

Concentration

Lyoph

Reconstitution Instructions

Please contact technical support for detailed reconstitution instructions.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TIRAP (TLR2 and TLR4)

TIRAP/Mal is an adapter protein in the signaling pathways activated by TLR2 and TLR4, and appears to be essential for MyD88-dependent TLR2 and TLR4 signaling pathways. TIRAP is recruited to activated TL2 and TLR4 through interaction with TIR domain of the receptor. This peptide contains a sequence from mouse TIRAP that blocks the function of TIRAP, likely through binding to the receptor and blocking TIR-TIR domain interaction between TIRAP and the receptor.

Alternate Names

adapter protein wyatt, Adaptor protein Wyatt, FLJ42305, MAL, MyD88 adapter-like protein, TIR domain-containing adapter protein, toll/interleukin-1 receptor domain-containing adapter protein, toll-interleukin 1 receptor (TIR) domain containing adaptor protein, Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein, Toll-like receptor adaptor protein, wyatt

Gene Symbol

TIRAP

Additional TIRAP (TLR2 and TLR4) Products

Product Documents for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Product Datasheets

Download Product Datasheets

Protocols & Manuals

Download NBP2-29331 - Protocol

Download MSDS

COA

Product Specific Notices for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Citations
Reviews