Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16596

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16596-100ul
NBP3-16596-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4W9A7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Angiopoietin-like Protein 3/ANGPTL3 Antibodies »

Product Summary for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Angiopoietin-like Protein 3/ANGPTL3 (Q9Y5C1). MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]

Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]

Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Western blot analysis of extracts of various cell lines, using Angiopoietin-like Protein 3/ANGPTL3 Rabbit mAb (NBP3-16596) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Immunohistochemistry of paraffin-embedded mouse kidney using Angiopoietin-like Protein 3/ANGPTL3 Rabbit mAb (NBP3-16596) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] -

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Confocal imaging of paraffin-embedded Rat liver using ANGPTL3 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
View 1 more images

Applications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Angiopoietin-like Protein 3/ANGPTL3

ANGPTL3 is a 460 amino acid protein that is found most commonly in the liver, but has also been shown to reside in kidney samples, and contains three domains consisting of a signal peptide, N-terminal coiled-coil and C-terminal Fibrinogen (FBN) like domain. This protein is involved with the lipid metabolism disease pathways in relation to low levels of LDL (low density lipoproteins), HDL (High density lipoproteins), and triglycerides in plasma. This protein plays a role in angiogenesis and has been shown to interact with ITGAV, ITGB3, and ITGA5, and work is being done to study the protein and the related hypobetalipoproteinemia and atherosclerosis involvement.

Alternate Names

AGNPT5, Ang-5, Angiopoietin-5, ANGPTL3

Gene Symbol

ANGPTL3

Additional Angiopoietin-like Protein 3/ANGPTL3 Products

Product Documents for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.