Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16077

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16077-100ul
NBP3-16077-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7T1R3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Chitinase 3-like 1/YKL-40 Antibodies »

Product Summary for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Chitinase 3-like 1 (NP_001267.2). PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of THP-1 cells, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Immunocytochemistry/Immunofluorescence: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Immunofluorescence analysis of THP-1 and K562 cells using Chitinase 3-like 1 Rabbit mAb (NBP3-16077) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]

Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of various cell lines, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
View 1 more images

Applications for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Chitinase 3-like 1/YKL-40

Chitinase 3-like 1 (CHI3L1), also called BRP39 in mouse or YKL-40 in humans, is a 39 kDa glycoprotein member of the glycosyl hydrolase 18 family although it does not show chitotriosidase activity. CHI3L1 is expressed by articular chondrocytes, synovial cells, activated monocyte-derived macrophages, neutrophils, endothelial cells, vascular smooth muscle cells, and some cancer cells. CHI3L1 binds to chitin and heparins, and it enhances cell adhesion, proliferation and tumor angiogenesis. Circulating CHI3L1 is elevated during inflammation and connective tissue remodeling such as arthritis, chronic obstructive pulmonary disease, diabetes, cardiovascular disease, inflammatory bowel disease, and liver cirrhosis. It is frequently upregulated in glioblastoma, myxoid chondrosarcoma, melanoma and carcinomas of the breast, thyroid, colon, lung, kidney, and ovary.

Alternate Names

CHI3L1, Chitinase 3 like 1, HCgp39, YKL-40

Gene Symbol

CHI3L1

Additional Chitinase 3-like 1/YKL-40 Products

Product Documents for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.