FGF basic/FGF2/bFGF Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57096

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57096
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all FGF basic/FGF2/bFGF Antibodies »

Product Summary for FGF basic/FGF2/bFGF Antibody

Immunogen

Synthetic peptides corresponding to FGF2(fibroblast growth factor 2 (basic)) The peptide sequence was selected from the middle region of FGF2. Peptide sequence RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FGF basic/FGF2/bFGF Antibody

Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2 Antibody [NBP1-57096] - Antibody Titration: 2 ug/ml ELISA Titer: 1 : 312500 Positive control: Hela cell lysate.
Immunohistochemistry: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Immunohistochemistry: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Immunohistochemistry: FGF basic/FGF2 Antibody [NBP1-57096] - Human A375 cells Primary Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-Alexa-546 Secondary Antibody Dilution: 1 : 100Color/Signal Descriptions: Red: FGF2 Blue: Nuclei.
Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2 Antibody [NBP1-57096] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for FGF basic/FGF2/bFGF Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGF basic/FGF2/bFGF

The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Fibroblast Growth Factor basic

Alternate Names

bFGF, FGF-2, FGF2, HBGF-2, Prostatropin

Gene Symbol

FGF2

Additional FGF basic/FGF2/bFGF Products

Product Documents for FGF basic/FGF2/bFGF Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FGF basic/FGF2/bFGF Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.