Skip to main content

Human/Rat Osteocalcin Alexa Fluor® 405-conjugated Antibody

R&D Systems, part of Bio-Techne | Catalog # IC1419V

R&D Systems, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Rat

Applications

Intracellular Staining by Flow Cytometry

Label

Alexa Fluor 405 (Excitation = 405 nm, Emission = 421 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # 190125

Product Specifications

Immunogen

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Specificity

Detects human Osteocalcin in direct ELISAs.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for Human/Rat Osteocalcin Alexa Fluor® 405-conjugated Antibody

Application
Recommended Usage

Intracellular Staining by Flow Cytometry

0.25-1 µg/106 cells
Sample: Saos-2 human osteosarcoma cell line and human osteoblasts were fixed with paraformaldehyde and permeabilized with saponin

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Formulation

Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store the unopened product at 2 - 8 °C. Do not use past expiration date.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma-Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References

  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Long Name

Bone gamma-Carboxyglutamate [gla] Protein

Alternate Names

BGLAP, BGP, OCN

Entrez Gene IDs

632 (Human); 12096 (Mouse); 25295 (Rat)

Gene Symbol

BGLAP

UniProt

Additional Osteocalcin Products

Product Documents for Human/Rat Osteocalcin Alexa Fluor® 405-conjugated Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Note: Certificate of Analysis not available for kit components.

Product Specific Notices for Human/Rat Osteocalcin Alexa Fluor® 405-conjugated Antibody


This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.

For research use only

Loading...
Loading...
Loading...
Loading...
Loading...