ACE-2 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-59036PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-59036PEP
Formulation | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: ACE-2
Genetic data from Drosophila, mice and rats show that the ACE2 protein is an essential regulator of heart function in vivo. ACE2 mRNA is found at high levels in testis, kidney and heart with moderate levels in colon, small intestine, and ovary. The ACE2 protein contributes to organ function through the renin-angiotensin system, playing a central role in vascular, renal, and myocardial physiology.
Virology research has demonstrated that the severe acute respiratory syndrome coronavirus (SARS-CoV) spike protein binds to its functional receptor, ACE2 (1). Vimentin is a type III intermediate filament protein expressed in mesenchymal cells that helps comprise the cytoskeleton in all animal cells. Studies have demonstrated that vimentin allows cell binding that allows the uptake of SARS-CoV spike protein into a host (2). This direct interaction of SARS-CoV with vimentin has been identified as an entry mechanism for the virus into a host, mediated by the SARS-CoV receptor ACE2 (1,2). It has been shown that ACE2 is the SARS-CoV-2 receptor required for cell entry and plays a physiological role in the replication of SARS-CoV in an infected host (1). Studies using human ACE2 antibody demonstrated a blockade of SARS-CoV-2 and ACE2 interaction, indicating an important physiological component of viral transmission and potential anti-viral therapeutic strategies (3).
References
1. Li, W., Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A., . . . Farzan, M. (2003). Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature, 426(6965), 450-454. doi:10.1038/nature02145
2. Yu YT, Chien SC, Chen IY, Lai CT, Tsay YG, Chang SC, Chang MF. (2016) Surface vimentin is critical for the cell entry of SARS-CoV. J Biomed Sci. doi: 10.1186/s12929-016-0234-7
3. Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kruger, N., Herrler, T., Erichsen, S., . . . Pohlmann, S. (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell. doi:10.1016/j.cell.2020.02.052
Long Name
Alternate Names
Gene Symbol
Additional ACE-2 Products
Product Documents for ACE-2 Recombinant Protein Antigen
Product Specific Notices for ACE-2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.