Skip to main content

Chitinase 3-like 1/YKL-40 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21409PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-21409PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Chitinase 3-like 1

Source: E.coli

Amino Acid Sequence: DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21409. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-21409PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Chitinase 3-like 1/YKL-40

Chitinase 3-like 1 (CHI3L1), also called BRP39 in mouse or YKL-40 in humans, is a 39 kDa glycoprotein member of the glycosyl hydrolase 18 family although it does not show chitotriosidase activity. CHI3L1 is expressed by articular chondrocytes, synovial cells, activated monocyte-derived macrophages, neutrophils, endothelial cells, vascular smooth muscle cells, and some cancer cells. CHI3L1 binds to chitin and heparins, and it enhances cell adhesion, proliferation and tumor angiogenesis. Circulating CHI3L1 is elevated during inflammation and connective tissue remodeling such as arthritis, chronic obstructive pulmonary disease, diabetes, cardiovascular disease, inflammatory bowel disease, and liver cirrhosis. It is frequently upregulated in glioblastoma, myxoid chondrosarcoma, melanoma and carcinomas of the breast, thyroid, colon, lung, kidney, and ovary.

Alternate Names

CHI3L1, Chitinase 3 like 1, HCgp39, YKL-40

Gene Symbol

CHI3L1

Additional Chitinase 3-like 1/YKL-40 Products

Product Documents for Chitinase 3-like 1/YKL-40 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Chitinase 3-like 1/YKL-40 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...