Skip to main content

DNAM-1/CD226 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-68690PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-68690PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAM-1/CD226.

Source: E. coli

Amino Acid Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68690.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-68690PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DNAM-1/CD226

CD226 is a 65kD type I transmembrane glycoprotein, known as DNAM-1 (DNAX accessory molecule-1), PTA1(platelet and T cell activation antigen 1), or TLiSA1 (T lineage-specific activation antigen 1 antigen). It belongs to immunoglobulin superfamily containing 2 Ig-like domains, is expressed on majority of T lymphocytes, NK cells, monocytes, platelets, and a subset of B cells, activated endothelial cells. DNAM-1 is also expressed on CD8+ (but not CD8-) dendritic cells in mouse model. CD226 is an adhesion molecule involved in CTL and NK cell-mediated cytotoxicity. It has been identified that CD155 (poliovirus receptor, PVR) and CD112 (nectin-2, PRR-2) are CD226 ligands. DX11 antibody is able to inhibit CTL and NK cell-mediated cytotoxicity, and to block T cell cytokine production.

Long Name

DNAX Accessory Molecule 1

Alternate Names

CD226, DNAM1, PTA1, TLiSA1

Gene Symbol

CD226

Additional DNAM-1/CD226 Products

Product Documents for DNAM-1/CD226 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DNAM-1/CD226 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...