ICAT/CTNNBIP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-59020PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-59020PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all ICAT Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICAT/CTNNBIP1.

Source: E. coli

Amino Acid Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59020.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-59020PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ICAT

CTNNBIP1, or Beta-catenin-interacting protein 1, consists of a short 81 amino acid isoform that is approximately 9 kDa, and is involved in the negative regulation of the Wnt signaling pathway, and it also prevents CTNNB1 and TCF from interacting. Current research is being conducted on CTNNBIP1 and a number of diseases to determine the relationship between the two. Some of these disorders and diseases include: actinic cheilitis, nasopharyngitis, adenomatous polyposis coli, gastric cancer, cheilitis, esophagitis, esophageal squamous cell carcinoma, laryngitis, desmoid tumor, hepatocellular carcinoma, acute lymphoblastic leukemia, medulloblastoma, malignant glioma, duodenitis, wilms tumor, endometrial carcinoma, and polyposis. CTNNBIP1 is linked to the Wnt signaling pathway, where it interacts with JUP, CTNNB1, BEND5, CASP4, and CPVL.

Long Name

Beta-Catenin-Interacting Protein

Alternate Names

CTNNBIP1

Gene Symbol

CTNNBIP1

Additional ICAT Products

Product Documents for ICAT/CTNNBIP1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ICAT/CTNNBIP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.