Kynureninase Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14180PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14180PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Kynureninase Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KYNU.

Source: E. coli

Amino Acid Sequence: YAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14180.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14180PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Kynureninase

KYNU, also known as Kynureninase, has a 465 amino acid long isoform that is 52 kDa and a short 307 amino acid that is 35 kDa; its highest expressed levels are found in placenta, liver and lung; is a PLP dependent enzyme that catalyses the cleavage of kynurenine (Kyn) into anthranilic acid (Ant), and It can also act on 3hKyn (to produce 3hAnt) and some other (3-arylcarbonyl)-alanines, and has cysteine-conjugate-beta-lyase activity. This protein is currently being studied for research on the following diseases and disorders: transient cerebral ischemia, vitamin b deficiency, hydroxykynureninuria, pellagra, cerebritis, ischemia, atopic dermatitis, intrahepatic cholangiocarcinoma, essential hypertension, noma, brain injury, dermatitis, psoriasis cholangiocarcinoma, neurologic diseases, interferon, and neuronitis. Interactions with KYNU protein have been shown to involve 40 proteins including GCK, PIN1, NEDD4L, HSPA9, and ETFA in tryptophan catabolism, metabolism, metabolism of amino acids and derivatives, and NAD metabolism pathways.

Alternate Names

KYNU, L-kynurenine hydrolase

Gene Symbol

KYNU

Additional Kynureninase Products

Product Documents for Kynureninase Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Kynureninase Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.