Skip to main content

Mcl-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-52968PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-52968PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mcl-1.

Source: E. coli

Amino Acid Sequence: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52968.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-52968PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Mcl-1

Mcl-1 (Myeloid cell leukemia-1) is Bcl-2-related and was identified as an early-induction gene that increased in expression during the differentiation of human myeloblastic leukemia cell ML-1, or exposure to different DNA damaging agents. The level of Mcl-1 is decreased in peripheral B lymphocytes undergoing apoptosis following treatment with apoptotic stimuli such as TGF-alpha 1 and forskolin. Expression of Mcl-1 is able to delay apoptosis induced by over-expression of c-myc in CHO 5AHSmyc cells. In hematopoietic FDC-P1 cells, Mcl-1 interacts with another Bcl-2-related protein, Bax, and prolongs cell viability after treatment with different apoptotic reagents.This monoclonal antibody detected a 37kd MCL1 in BCBL-1 cell lysate.

Long Name

Myeloid Cell Leukemia Sequence 1

Alternate Names

BCL2L3, Mcl1

Gene Symbol

MCL1

Additional Mcl-1 Products

Product Documents for Mcl-1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Mcl-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...