MYCBP2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-68745PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-68745PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MYCBP2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYCBP2.

Source: E. coli

Amino Acid Sequence: CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68745.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-68745PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MYCBP2

In addition to its possible functions as a facilitator of Myc activated transcription, PAM (protein associated with Myc) has also been shown to play a role in mTOR signaling. PAM functions as an E3 ubiquitin ligase for tuberin (TSC2), a negative regulator of the mTOR pathway. Additionally PAM has been shown to function as a guanosine exchange factor (GEF) for Rheb and to facilitate sphingosine-1-phosphate signaling in the mTOR pathway. Alternative names for PAM include Myc-binding protein 2, MYCBP2, Pam/highwire/rpm-1 protein, and KIAA0916.

Alternate Names

DKFZp686M08244, EC 6.3.2.-, FLJ10106, FLJ21646, KIAA0916FLJ13826, MYC binding protein 2, Myc-binding protein 2, Pam/highwire/rpm-1 protein, PAMFLJ21597, probable E3 ubiquitin-protein ligase MYCBP2, Protein associated with Myc

Gene Symbol

MYCBP2

Additional MYCBP2 Products

Product Documents for MYCBP2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MYCBP2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.