Recombinant Human PGC1 alpha GST (N-Term) Protein

Name: Recombinant Human PGC1 alpha GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00010891-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00010891-Q01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all PGC1 alpha Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 689-798 of Human PGC1 alpha

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PGC1 alpha GST (N-Term) Protein

Recombinant Human, PGC1 alpha Protein [H00010891-Q01] - 12.5% SDS-PAGE using Recombinant Human PGC1 alpha Protein stained with Coomassie Blue.

Formulation, Preparation and Storage

H00010891-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: PGC1 alpha

Peroxisome proliferator-activated receptor-gamma coactivator 1-alpha (PGC-1alpha), PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha (theoretical molecular weight 91 kDa) belongs to a family of transcription coactivators which includes two other proteins; PGC-1beta and PGC-1-related coactivators. PGC1 alpha interacts with various transcription factors (e.g., FOXO1, PPAR-(alpha, delta and gamma), LXR and FXR), promoting the transactivation of their specific target genes (1). As a transcription coactivator, PGC1 alpha is found in the nucleus where it interacts with transcriptional activators and chromatin modifiers such as p300/CBP and SRC-1 to induce targeted gene expression (1, 2). Transcription factors which interact with PGC1 alpha are involved in several functions related to cellular energy homeostasis including mitochondrial biogenesis, glucose and fatty acid metabolism, and skeletal muscle remodeling. Upstream regulators of PGC1 alpha activity include proteins that play a central role as energy sensors including SIRT1 and AMPK which, through different mechanisms, induce PGC1 alpha activity (3).

PGC1 alpha is highly expressed in skeletal muscle, cardiac muscle, and brown adipose tissue, all tissues with high oxidative capacity (1, 2). PGC1 alpha is also induced by energy taxing physiological states, for example increased physical activity, reduced body temperature, and reduced food intake (3). Because of its role in pathways controlling cellular energy expenditure, PGC1 alpha dysfunction has been associated with pathophysiological conditions such as type 2 diabetes and the metabolic syndrome (3).

References

1.Liang, H., & Ward, W. F. (2006). PGC-1alpha: A key regulator of energy metabolism. American Journal of Physiology - Advances in Physiology Education. https://doi.org/10.1152/advan.00052.2006

2.Arany, Z., He, H., Lin, J., Hoyer, K., Handschin, C., Toka, O., ... Spiegelman, B. M. (2005). Transcriptional coactivator PGC-1alpha controls the energy state and contractile function of cardiac muscle. Cell Metabolism. https://doi.org/10.1016/j.cmet.2005.03.002

3.Canto, C., & Auwerx, J. (2009). PGC-1alpha, SIRT1 and AMPK, an energy sensing network that controls energy expenditure. Current Opinion in Lipidology. https://doi.org/10.1097/MOL.0b013e328328d0a4

Long Name

Peroxisome Proliferator-activated Receptor gamma, Coactivator 1 alpha

Alternate Names

LEM6, PPARGC1A

Gene Symbol

PPARGC1A

Additional PGC1 alpha Products

Product Documents for Recombinant Human PGC1 alpha GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human PGC1 alpha GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews