Skip to main content

UBIAD1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55187PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55187PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBIAD1.

Source: E. coli

Amino Acid Sequence: MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55187.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55187PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: UBIAD1

UBIAD1 is a novel gene designated TERE1 that has a significant effect on the growth regulation in bladder cancer. The TERE1 gene maps to a chromosome locus that has been identified, in loss of heterozygosity studies, as a site of a putative tumor suppressor gene or genes for multiple tumor types including prostate carcinoma. Data suggest that TERE1 may be significant in prostate cancer growth regulation, and the down regulation or absence of TERE1 may be an important component of the phenotype of advanced disease. Data also suggest a potential role for this gene product in the progression of bladder cancer.

Alternate Names

EC 2.5.1.-, RP4-796F18.1, SCCD, Schnyder crystalline corneal dystrophy, TERE1transitional epithelia response protein, Transitional epithelial response protein 1, UbiA prenyltransferase domain containing 1, ubiA prenyltransferase domain-containing protein 1

Gene Symbol

UBIAD1

Additional UBIAD1 Products

Product Documents for UBIAD1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for UBIAD1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...