VE-Cadherin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21223PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-21223PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all VE-Cadherin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VE-Cadherin

Source: E.coli

Amino Acid Sequence: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21223. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-21223PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: VE-Cadherin

VE-cadherin (cadherin-5) is an endothelial specific adhesion molecule that is essential for the maintenance of endothelial barrier function and angiogenesis. VE-cadherin is linked to the actin cytoskeleton through a number of adaptor proteins including a-, â-, and ã-catenin. Cytoskeletal dynamics and phosphorylation regulate VE-cadherin mediated cell-cell adhesion. The cytosolic C-terminal Src kinase (Csk) binds via its SH2 domain to the phosphorylated tyrosine 658 site of VE-cadherin. This interaction regulates density dependent cell proliferation. Phosphorylation of tyrosine 658 has also been shown to lead to the uncoupling of p120-catenin from the cytoplasmic tail of VE-cadherin. This phosphorylation event is sufficient to maintain cells in a mesenchymal state during the cell invasion phase of angiogenesis.

Long Name

Vascular Endothelium Cadherin

Alternate Names

Cadherin-5, CD144, CDH5, VECadherin

Gene Symbol

CDH5

Additional VE-Cadherin Products

Product Documents for VE-Cadherin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VE-Cadherin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.