Skip to main content

Wnt-10b Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56449PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56449PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Wnt-10b.

Source: E. coli

Amino Acid Sequence: SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56449.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56449PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Wnt-10b

Researchers have indicated that they want access to novel target antibodies quickly to aid in their research. Novus is pleased to offer researchers access to products that are not fully characterized or validated. This antibody is shown by Peptide ELISA to bind to the peptide used as immunogen. Investigators should empirically determine the suitability of the antibody, including optimal dilutions, for other applications of interest. * We cannot guarantee that this antibody will work in any application other than in a Peptide ELISA against the peptide used as immunogen and therefore can not offer a refund if the antibody does not work in your application. * The antibody is offered at a lower price compared to more highly validated antibodies. * We are not able to provide the peptide used as immunogen for this product. As this antibody is not fully validated we appreciate your feedback. Customer feedback is used to help generate testing methodologies which can lead to further product validation or withdrawal.__________________________ Wnts comprise a family of secreted signaling proteins that regulate diverse developmental processes. Activation of Wnt signaling by Wnt10b inhibits differentiation of preadipocytes and blocks adipose tissue development. In bone development, Wnt10b shifts cell fate toward the osteoblast lineage.

Long Name

Wingless-type MMTV Integration Site Family, Member 10B

Alternate Names

Wnt-12, Wnt10b

Gene Symbol

WNT10B

Additional Wnt-10b Products

Product Documents for Wnt-10b Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Wnt-10b Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...