ABCD2 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92633

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-92633-0.02ml
NBP2-92633-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all ABCD2 Antibodies »

Product Summary for ABCD2 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 420-500 of human ABCD2 (NP_005155.1). TARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAGEVVASRLNFK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ABCD2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ABCD2 Antibody - Azide and BSA Free [NBP2-92633]

Immunocytochemistry/ Immunofluorescence: ABCD2 Antibody - Azide and BSA Free [NBP2-92633]

Immunocytochemistry/Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of L929 cells using ABCD2 . Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ABCD2 Antibody - Azide and BSA Free [NBP2-92633]

Immunocytochemistry/ Immunofluorescence: ABCD2 Antibody - Azide and BSA Free [NBP2-92633]

Immunocytochemistry/Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of U-2 OS cells using ABCD2 . Blue: DAPI for nuclear staining.

Applications for ABCD2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ABCD2

The protein encoded by the ABCD2 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCproteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into sevendistinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily,which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomalABC transporters are half transporters which require a partner half transporter molecule to form a functionalhomodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown; however thisprotein is speculated to function as a dimerization partner of ABCD1 and/or other peroxisomal ABC transporters.Mutations in this gene have been observed in patients with adrenoleukodystrophy, a severe demyelinating disease. Thisgene has been identified as a candidate for a modifier gene, accounting for the extreme variation amongadrenoleukodystrophy phenotypes. This gene is also a candidate for a complement group of Zellweger syndrome, agenetically heterogeneous disorder of peroxisomal biogenesis. (provided by RefSeq)

Alternate Names

Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein, ALD1, ALDL1ATP-binding cassette sub-family D member 2, ALDRhALDR, ALDRPABC39, ATP-binding cassette, sub-family D (ALD), member 2

Gene Symbol

ABCD2

Additional ABCD2 Products

Product Documents for ABCD2 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ABCD2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.