ADTB1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86958

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86958
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all ADTB1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADTB1. Peptide sequence: PSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ADTB1 Antibody

Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958] - Host: Rabbit. Target Name: AP1B1. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958]

Western Blot: ADTB1 Antibody [NBP2-86958] - Host: Mouse. Target Name: AP1B1. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

Applications for ADTB1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADTB1

Membrane vesicle formation is a process required for the endocytosis and biosynthesis of various secreted and membrane bound proteins. Clathrin is a protein which assembles into a polyhedral network on the cell membrane as the membrane invaginates, forming a coated pit which is essential to endocytosis. Clathrin is composed of three polypeptides, a 180 kDa heavy chain and two 32-38 kDa light chains which combine to create a distinct three-legged triskelion. It is this morphology which allows Clathrin to form its unique polyhedral network.

Alternate Names

Adapter-Related Protein Complex 1 Subunit Beta-1, Adaptor Protein Complex AP-1 Subunit Beta-1, Adaptor-Related Protein Complex 1, Beta 1 Subunit, AP-1 Complex Subunit Beta-1, AP105A, AP1B1, BAM22, Beta-1-adaptin, beta1-adaptin, Beta-Adaptin 1, beta-prime-adaptin, CLAPB2, Clathrin Assembly Protein Complex 1 Beta Large Chain, Golgi Adaptor HA1/AP1 Adaptin Beta Subunit, Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit

Gene Symbol

AP1B1

Additional ADTB1 Products

Product Documents for ADTB1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ADTB1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.