Advillin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-34118

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-34118
NBP2-34118-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Predicted:

Mouse (90%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Advillin Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Advillin Antibody

Immunohistochemistry: Advillin Antibody [NBP2-34118]

Immunohistochemistry: Advillin Antibody [NBP2-34118]

Immunohistochemistry: Advillin Antibody [NBP2-34118] - Immunohistochemistry of paraffin embedded tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter stained with DAPI. N-villin antibody does not cross-react with advillin in cells that express advillin in apical tufts and along the basolateral surface. Right panel shows higher magnification of boxed area. (d) Immunohistochemistry of cryopreserved tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter stained with DAPI. N-villin does not co-localize with advillin in cells that express advillin in apical tufts and along the basolateral surface. Right panel shows higher magnification of boxed area. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/s41598-020-65469-0) licensed under a CC-BY license.
Western Blot: Advillin Antibody [NBP2-34118]

Western Blot: Advillin Antibody [NBP2-34118]

Western Blot: Advillin Antibody [NBP2-34118] - Specificity of villin and advillin antibodies was confirmed by Western analysis using recombinant full-length human villin and human advillin proteins. Two antibodies raised against the amino-terminus of villin (N-villin and N20-villin) did not cross-react with advillin compared to antibodies raised against the carboxyl-terminus of villin (C-villin) or full-length villin (FL-villin) protein. Antibodies raised against the amino-terminus of advillin (N-advillin) and those raised against the carboxyl-terminus of advillin (C-advillin) detect advillin better than they cross-react with villin. Original full length data are available in supplementary Fig S1. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/s41598-020-65469-0) licensed under a CC-BY license.
Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118]

Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118]

Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human lymphoid tissues shows no positivity as expected.
View 2 more images

Applications for Advillin Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Advillin

Advillin, also known as AVIL, contains two isoforms that are 92 kDa and 91 kDa, and is involved in the development of ganglia and the regeneration and remodeling of axons after a peripheral injury occurs. Current research is being conducted on this calcium regulated actin-binding protein to determine its relation with a variety of diseases and disorders, including petit mal status, prostatitis, inflammatory bowel disease, neuronitis, dengue hemorrhagic fever, dacryoadenitis, and dengue shock syndrome. Advillin has been linked to stress response, cytoskeleton organization, and nervous system development, through which it interacts with proteins CRK and HDAC8.

Alternate Names

ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812

Gene Symbol

AVIL

UniProt

O75366 (Human)

Additional Advillin Products

Product Documents for Advillin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Advillin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.