AHRR Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10415

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10415-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all AHRR Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_033774). Peptide sequence CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AHRR Antibody

Western Blot: AHRR Antibody [NBP3-10415]

Western Blot: AHRR Antibody [NBP3-10415]

Western Blot: AHRR Antibody [NBP3-10415] - Western blot analysis of AHRR in Mouse Muscle as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for AHRR Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AHRR

AHRR, or Aryl hydrocarbon receptor repressor, contains a 76 kDa, 78 kDa, and 77 kDa isoform, and mediates and regulates cell growth, transcription activity, and differentiation. Disease research is currently being conducted on AHRR and its relation to a variety of disorders and diseases, including dysgammaglobulinemia, ovarian cystadenoma, esophageal squamous cell carcinoma, male infertility, laryngitis, hepatitis, endometriosis, pulmonary disease, azoosperima, lung cancer, fibrosis, and esophagitis. This protein interacts with HDAC4, ANKRA2, ARNT, ESR1, and HADC5 in the AHR Pathway.

Alternate Names

AHH, AHHR, AhR repressor, AhRR, aryl hydrocarbon receptor regulator, aryl hydrocarbon receptor repressor, arylhydrocarbon receptor repressor, aryl-hydrocarbon receptor repressor, BHLHE77, Class E basic helix-loop-helix protein 77, dioxin receptor repressor, KIAA1234bHLHe77aryl hydrocarbon hydroxylase regulator, MGC167813, MGC176630

Gene Symbol

AHRR

Additional AHRR Products

Product Documents for AHRR Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AHRR Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.