AIBZIP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10830

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10830-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all AIBZIP Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AIBZIP (NP_001242907.1). Peptide sequence HLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AIBZIP Antibody

Western Blot: AIBZIP Antibody [NBP3-10830]

Western Blot: AIBZIP Antibody [NBP3-10830]

Western Blot: AIBZIP Antibody [NBP3-10830] - Western blot analysis of AIBZIP in Human HepG2 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for AIBZIP Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AIBZIP

Androgen-induced basic leucine zipper (AIBZIP)is a transcription factor. AIbZIP is a 395 aa protein with homology to cyclic AMP-responsive element binding protein/activating transcription factor. It contains an NH(2)-terminal activation domain, a central bZIP domain, and a COOH-terminal transmembrane domain. Immunoreactive AIbZIP protein has been detected in the cytoplasm of prostatic luminal epithelial cells; full-length AIbZIP-GFP fusion proteins are localized in the cytoplasm of LNCaP cells, while a truncated form of AIbZIP lacking the putative transmembrane domain was exclusively nuclear. AIbZIP is expressed at higher levels in cancerous prostate cells compared with noncancerous prostate cells.

Alternate Names

AIbZIP, AIBZIPcAMP-responsive element-binding protein 4, Androgen-induced basic leucine zipper protein, ATCE1JAL, Attaching to CRE-like 1, cAMP responsive element binding protein 1, cAMP responsive element binding protein 3-like 4, CREB3, CREB4CREB-4, cyclic AMP-responsive element-binding protein 3-like protein 4, Cyclic AMP-responsive element-binding protein 4, hJALcAMP-responsive element-binding protein 3-like protein 4, Tisp40, Transcript induced in spermiogenesis protein 40

Gene Symbol

CREB3L4

Additional AIBZIP Products

Product Documents for AIBZIP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AIBZIP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.