Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69558

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69558
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Airway Trypsin-like Protease/HAT Antibodies »

Product Summary for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

Immunogen

Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the middle region of TMPRSS11D. Peptide sequence IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

Western Blot: Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody [NBP1-69558]

Western Blot: Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody [NBP1-69558]

Western Blot: Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody [NBP1-69558] - 293T tissue lysate at a concentration of 1ug/ml.

Applications for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Airway Trypsin-like Protease/HAT

TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.

Long Name

Human Airway Trypsin-like Protease

Alternate Names

TMPRSS11D

Gene Symbol

TMPRSS11D

UniProt

O60235

Additional Airway Trypsin-like Protease/HAT Products

Product Documents for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.