Alanyl tRNA synthetase Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57136

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57136
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Alanyl tRNA synthetase Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Alanyl tRNA synthetase Antibody

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136]

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136]

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml AARS is supported by BioGPS gene expression data to be expressed in Jurkat
Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136]

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136]

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell processes of pinealocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136]

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136]

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate AARS is supported by BioGPS gene expression data to be expressed in Jurkat
View 2 more images

Applications for Alanyl tRNA synthetase Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Alanyl tRNA synthetase

The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure. [provided by RefSeq]

Alternate Names

alanine tRNA ligase 1, cytoplasmic, Alanine--tRNA ligase, alanyl-tRNA synthetase, alanyl-tRNA synthetase, cytoplasmic, AlaRS, CMT2N, EC 6.1.1, EC 6.1.1.7, Renal carcinoma antigen NY-REN-42

Entrez Gene IDs

16 (Human)

Gene Symbol

AARS1

UniProt

P49588 (Human)

Additional Alanyl tRNA synthetase Products

Product Documents for Alanyl tRNA synthetase Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Alanyl tRNA synthetase Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.