ALG6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-62495

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-62495
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ALG6 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ALG6(asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase)) The peptide sequence was selected from the N terminal of ALG6. Peptide sequence PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ALG6 Antibody

Western Blot: ALG6 Antibody [NBP1-62495]

Western Blot: ALG6 Antibody [NBP1-62495]

Western Blot: ALG6 Antibody [NBP1-62495] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for ALG6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALG6

ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 6 homolog (S. cerevisiae, asparagine-linked glycosylation 6 homolog (yeast, asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 6 homolog, CDG1C, dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase, EC 2.4.1, EC 2.4.1.-, Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase

Gene Symbol

ALG6

UniProt

Q9Y672 (Human)

Additional ALG6 Products

Product Documents for ALG6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ALG6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.