alpha 1 Mannosidase 1A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-37938

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-37938
NBP2-37938-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all alpha 1 Mannosidase 1A Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha 1 Mannosidase 1A Antibody

Immunocytochemistry/ Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NBP2-37938]

Immunocytochemistry/ Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NBP2-37938]

Immunocytochemistry/Immunofluorescence: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: alpha 1 Mannosidase 1A Antibody [NBP2-37938]

Immunohistochemistry-Paraffin: alpha 1 Mannosidase 1A Antibody [NBP2-37938]

Immunohistochemistry-Paraffin: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human liver shows moderate positivity in bile canaliculi.
Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NBP2-37938]

Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NBP2-37938]

Immunohistochemistry: alpha 1 Mannosidase 1A Antibody [NBP2-37938] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
View 2 more images

Applications for alpha 1 Mannosidase 1A Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha 1 Mannosidase 1A

a1,2-Mannosidase IA is a Type II transmembrane Golgi-resident enzyme that belongs to class I a1,2-Mannosidases (glycosylhydrolase family 47). a1,2-Mannosidases plays an essential role in the maturation of N-glycans to hybrid and complex oligosaccharides in mammalian cells. Class I a1,2- Mannosidases are conserved through evolution. They can be classified into three subgroups according to their enzymatic activities. The first subgroup includes yeast and human endoplasmic reticulum (ER) a1,2-Mannosidases that primarily trim Man9GlcNAc2 to Man8GlcNAc2 isomer B. The second subgroup includes mammalian Golgi a1,2-Mannosidases IA, IB, and IC that trim Man9GlcNAc2 to Man5GlcNAc2 through Man8GlcNAc2 isomer A and C. These Golgi mannosidases display different tissue- and cell-specific expression, subcellular localization, and substrate specificity. The third subgroup includes yeast and mammalian proteins that do not hydrolyze Man9GlcNAc2. Proteins from subgroup 1 and 3 have been implicated in ER quality control and in proteasomal degradation of misfolded glycoproteins. It was also suggested that Golgi mannosidases from the second subgroup may play a role in the ERAD (endoplasmic reticulum-associated degradation) of defective glycoproteins 1-5. Although a1,2-Mannosidase IA is predominantly detected in the juxtanuclear Golgi region by indirect immunofluorescence, significant cell type and speciesdependent variation in localization was reported. The pig liver enzyme has been localized to the ER and transitional vesicles between ER and Golgi, but is not found within the Golgi stacks of porcine hepatocytes.

Alternate Names

Alpha-1,2-mannosidase IA, EC 3.2.1, EC 3.2.1.113, HUMM3, HUMM9, man(9)-alpha-mannosidase, MAN9, Man9-mannosidase, Mannosidase alpha class 1A member 1, mannosidase, alpha, class 1A, member 1, mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, Processing alpha-1,2-mannosidase IA

Gene Symbol

MAN1A1

UniProt

P33908 (Human)

Additional alpha 1 Mannosidase 1A Products

Product Documents for alpha 1 Mannosidase 1A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for alpha 1 Mannosidase 1A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.