alpha-Internexin Antibody (5E5Z3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16230

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16230-100ul
NBP3-16230-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5E5Z3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all alpha-Internexin Antibodies »

Product Summary for alpha-Internexin Antibody (5E5Z3)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human alpha-Internexin (Q16352). EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-Internexin Antibody (5E5Z3)

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Western blot analysis of extracts of various cell lines, using alpha-Internexin Rabbit mAb (NBP3-16230) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of mouse brain using alpha-Internexin Rabbit mAb (NBP3-16230) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Immunohistochemistry-Paraffin: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Immunohistochemistry-Paraffin: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry of paraffin-embedded rat brain using alpha-Internexin Rabbit mAb (NBP3-16230) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for alpha-Internexin Antibody (5E5Z3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha-Internexin

Alpha-internexin is a Class IV intermediate filament, related to but distinct from the better known neurofilament triplet proteins, NF-L, NF-M and NF-H. It is expressed only in neurons and in large amounts early in neuronal development, but is down-regulated in many neurons as development procedes. However, many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H, and some mature neurons only express the alpha-internexin subunit of neurofilament.

The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.

Alternate Names

alphaInternexin, INA, NEF5, NF-66, TXBP-1

Gene Symbol

INA

Additional alpha-Internexin Products

Product Documents for alpha-Internexin Antibody (5E5Z3)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for alpha-Internexin Antibody (5E5Z3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.