alpha Tubulin 3c Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-53026

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-53026
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all alpha Tubulin 3c Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TUBA3C(tubulin, alpha 3c) The peptide sequence was selected from the N terminal of TUBA3C. Peptide sequence VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for alpha Tubulin 3c Antibody

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026]

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026]

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Jurkat, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026]

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026]

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026]

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026]

Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Hela, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in HeLa.

Applications for alpha Tubulin 3c Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha Tubulin 3c

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Tubulin alpha-3C chain

Alternate Names

Alpha-tubulin 2, TUBA2, TUBA3C

Gene Symbol

TUBA3C

Additional alpha Tubulin 3c Products

Product Documents for alpha Tubulin 3c Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for alpha Tubulin 3c Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.