AlphaA Crystallin/CRYAA Antibody (1T1F5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16559

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16559-100ul
NBP3-16559-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1T1F5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all AlphaA Crystallin/CRYAA Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human AlphaA Crystallin/CRYAA (P02489). QHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AlphaA Crystallin/CRYAA Antibody (1T1F5)

Western Blot: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Western Blot: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Western Blot: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] - Western blot analysis of extracts of various cell lines, using AlphaA Crystallin/CRYAA Rabbit mAb (NBP3-16559) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] - Immunofluorescence analysis of mouse eye using AlphaA Crystallin/CRYAA Rabbit mAb (NBP3-16559) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] - Immunofluorescence analysis of rat eye using AlphaA Crystallin/CRYAA Rabbit mAb (NBP3-16559) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for AlphaA Crystallin/CRYAA Antibody (1T1F5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AlphaA Crystallin/CRYAA

Lens proteins consist almost entirely of crystallins (about 95%). Crystallins are also found vertebrate skeletal muscle tissue. In the lens, their structural function is to assist in maintaining the proper refractive index of the lens. The mammalian lens contains 3 major classes of crystallins: alpha, beta, and gamma. Alpha-crystallin is the largest of the crystallins and is composed of 2 primary gene products--alpha-A and alpha-B. There are at least 5 different proteins comprising the beta-crystallins. The gamma-crystallins are monomeric, but there are at least 5 gamma crystallins identified in bovine and rat lens. Alpha-Crystallin comprises 40% of total lens protein composition. In addition to maintaining proper refractive index, it also functions in a chaperone like manner by preventing the formation of aggregates possibly leading to cataract formation. It is believed that the phosphorylated states of the alpha-crystallin occur in response to cellular stress and may serve a structural control function and play a role in protein maintenance. Alpha-B crystallin has been linked to Alexander®s disease where it accumulates in brain cells of those afflicted.

Alternate Names

CRYA1, CRYAA, HSPB4

Gene Symbol

CRYAA

Additional AlphaA Crystallin/CRYAA Products

Product Documents for AlphaA Crystallin/CRYAA Antibody (1T1F5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for AlphaA Crystallin/CRYAA Antibody (1T1F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.