Apc7 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10655

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10655-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Apc7 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Apc7 (NP_001100612). Peptide sequence NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Apc7 Antibody

Western Blot: Apc7 Antibody [NBP3-10655]

Western Blot: Apc7 Antibody [NBP3-10655]

Western Blot: Apc7 Antibody [NBP3-10655] - Western blot analysis of Apc7 in Rat Stomach lysates. Antibody dilution at 1.0ug/ml

Applications for Apc7 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apc7

APC7 (anaphase-promoting complex subunit 7) is a member of the E3 enzyme family. This protein contains TPR repeats and has a molecular weight of approximately 63 kD. The APC7 protein is located in the nucleus during interphase and the centrosome during metaphase/anaphase. This protein probably recruits Cdh1 into the APC complex. The APC7 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC7 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. The Poly6113 antibody has been shown to be useful for Western blotting of the human APC7 protein.

Alternate Names

anaphase promoting complex subunit 7, anaphase-promoting complex subunit 7, APC7Cyclosome subunit 7

Gene Symbol

ANAPC7

Additional Apc7 Products

Product Documents for Apc7 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Apc7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.