Apolipoprotein E/ApoE Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49450

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49450
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Apolipoprotein E/ApoE Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein E/ApoE Antibody

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Analysis in human liver and pancreas tissues. Corresponding APOE RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-APOE antibody NBP2-49450 (A) shows similar protein distribution across tissues to independent antibody NBP2-49565 (B).
Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Analysis in human plasma.
View 5 more images

Applications for Apolipoprotein E/ApoE Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein E/ApoE

Apolipoprotein E (APOE) is an apolipoprotein located in chylomicrons and intermediate-density lipoproteins that is necessary for the normal catabolism of triglyceride-rich lipoprotein constituents in the liver. APOE has recently been shown to be involseveral biological processes other than lipoprotein transport, including cognition and immunoregulation.

Lipoproteins are responsible for carrying cholesterol and other fats through the bloodstream as little packages and are essential for the normal breakdown of these molecules. In particular, apolipoprotein E is a major component of specific lipoproteins called very low-density lipoproteins (VLDL). A major function of VLDLs is to remove excess cholesterol from the blood and carry it to the liver for processing. Maintaining normal levels of cholesterol is essential for the prevention of cardiovascular diseases, including heart attacks and strokes.

The three Apo E isoforms are strongly associated with cardiovascular disease and Alzheimer's disease, so ApoE antibodies have become useful tools for research in both of these areas.

Alternate Names

APOE

Gene Symbol

APOE

Additional Apolipoprotein E/ApoE Products

Product Documents for Apolipoprotein E/ApoE Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein E/ApoE Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.