ARFIP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-39002

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-39002
NBP2-39002-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all ARFIP1 Antibodies »

Product Summary for ARFIP1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARFIP1 Antibody

Immunocytochemistry/ Immunofluorescence: ARFIP1 Antibody [NBP2-39002]

Immunocytochemistry/ Immunofluorescence: ARFIP1 Antibody [NBP2-39002]

Immunocytochemistry/Immunofluorescence: ARFIP1 Antibody [NBP2-39002] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry: ARFIP1 Antibody [NBP2-39002] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
View 2 more images

Applications for ARFIP1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARFIP1

ADP-ribosylation factors, or ARFs, enhance the ADP ribosyltransferase activity of cholera toxin and are implicated in vesicle transport between endoplasmic reticulum and the Golgi complex. Arfaptin 1 is recruited from the cytosol to Golgi membranes by ARFs in a guanosine 5'-O-(3-thiotriphosphate)-dependent and brefeldin A-sensitive manner but is not a constituent of coatomer. Arfaptin 1 binds to nonmyristoylated GTP-bound ARF3, but not to GDP-bound ARF3, and also to ARF1, another class I ARF. It binds with lower affinity to ARF5, a class II ARF, and with very little affinity to ARF6, a class III ARF. POR1 (also designated arfaptin 2) was first isolated as a Rac 1 binding protein necessary for Rac mediated Actin polymerization and the subsequent formation of membrane ruffles and lamellipodia. POR1 has also been shown to interact with the ADP ribosylation factor ARF6, a GTPase that associates with the plasma membrane and intracellular endosome vesicles, in a GTP dependent manner. The association of POR1 with ARF6 stimulates induction of Actin polymerization. POR1 appears to play a regulatory role through multiple signaling pathways in the reorganization of the cytoskeletal structure.

Alternate Names

ADP-ribosylation factor interacting protein 1, ADP-ribosylation factor-interacting protein 1, arfaptin 1, arfaptin-1, HSU52521, MGC117369

Gene Symbol

ARFIP1

UniProt

P53367 (Human)

Additional ARFIP1 Products

Product Documents for ARFIP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ARFIP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.