ASB5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59065

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59065
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ASB5 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ASB5(ankyrin repeat and SOCS box-containing 5) The peptide sequence was selected from the C terminal of ASB5. Peptide sequence LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ASB5 Antibody

Western Blot: ASB5 Antibody [NBP1-59065]

Western Blot: ASB5 Antibody [NBP1-59065]

Western Blot: ASB5 Antibody [NBP1-59065] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for ASB5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASB5

ASB5 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but their full length sequences are not known.

Alternate Names

ankyrin repeat and SOCS box containing 5, ankyrin repeat and SOCS box protein 5, ankyrin repeat and SOCS box-containing 5, ASB-5, SOCS box protein ASB-5

Gene Symbol

ASB5

UniProt

Q8WWX0 (Human)

Additional ASB5 Products

Product Documents for ASB5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ASB5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.