Asparagine synthetase Antibody (7M10Z7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15328

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15328-100ul
NBP3-15328-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7M10Z7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Asparagine Synthetase/ASNS Antibodies »

Product Summary for Asparagine synthetase Antibody (7M10Z7)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Asparagine synthetase (P08243). ETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSAR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Asparagine synthetase Antibody (7M10Z7)

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328] - Western blot analysis of extracts of various cell lines, using Asparagine synthetase Rabbit mAb (NBP3-15328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328] - Western blot analysis of extracts of MCF7 cells, using Asparagine synthetase Rabbit mAb (NBP3-15328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Asparagine synthetase Antibody (7M10Z7)

Application
Recommended Usage

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Asparagine Synthetase/ASNS

Asparagine synthetase (AS) is a housekeeping enzyme responsible for the production of asparagine from aspartate and glutamine. Most mammalian cells express AS and regulate the level of activity in response to the concentration of asparagine in the medium. Certain tumor cells in contrast, exhibit little or no AS activity and rely on the surrounding medium as a source of exogenous asparagines (1). Therefore tumor cells may be selectively killed by a chemotherapeutic drug using asparaginase. This approach has been exploited in the treatment of certain cancers like childhood acute lymphoblastic leukemia (2).

Long Name

ASNS

Alternate Names

ASNSD, EC 6.3.5.4, Glutamine Dependent Asparagine Synthetase, TS11 Cell Cycle Control Protein

Gene Symbol

ASNS

Additional Asparagine Synthetase/ASNS Products

Product Documents for Asparagine synthetase Antibody (7M10Z7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Asparagine synthetase Antibody (7M10Z7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.