Aspartate Aminotransferase Antibody (5J1B4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15347

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15347-100ul
NBP3-15347-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5J1B4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Aspartate Aminotransferase Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Aspartate Aminotransferase (NP_002070.1). AAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aspartate Aminotransferase Antibody (5J1B4)

Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]

Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]

Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] - Western blot analysis of extracts of various cell lines, using Aspartate Aminotransferase Rabbit mAb (NBP3-15347) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]

Immunocytochemistry/ Immunofluorescence: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]

Immunocytochemistry/Immunofluorescence: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] - Immunofluorescence analysis of HeLa cells using Aspartate Aminotransferase Rabbit mAb (NBP3-15347) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]

Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]

Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] - Western blot analysis of extracts of various cell lines, using Aspartate Aminotransferase Rabbit mAb (NBP3-15347) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for Aspartate Aminotransferase Antibody (5J1B4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aspartate Aminotransferase

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq]

Alternate Names

aspartate aminotransferase, cytoplasmic, ASTQTL1, CASPAT, CCAT, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, EC 2.6.1.1, EC 2.6.1.3, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), GOT1, growth-inhibiting protein 18, Transaminase A

Gene Symbol

GOT1

Additional Aspartate Aminotransferase Products

Product Documents for Aspartate Aminotransferase Antibody (5J1B4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Aspartate Aminotransferase Antibody (5J1B4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.