ATP5J2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84481

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84481-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all ATP5J2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATP5J2. Peptide sequence: LEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATP5J2 Antibody

Western Blot: ATP5J2 Antibody [NBP2-84481]

Western Blot: ATP5J2 Antibody [NBP2-84481]

Western Blot: ATP5J2 Antibody [NBP2-84481] - Host: Rabbit. Target Name: ATP5J2. Sample Tissue: Human HT1080 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for ATP5J2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5J2

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the innermembrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalyticcore, F1, and the membrane-spanning component, F0, which comprises the proton channel. The catalytic portion ofmitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with astoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The protonchannel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the F0 complex.Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This genehas multiple pseudogenes. (provided by RefSeq)

Alternate Names

ATP synthase f chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2, ATP5JLATP synthase subunit f, mitochondrial, F1F0-type ATPase subunit f, F1Fo-ATP synthase complex Fo membrane domain f subunit, F1Fo-ATPase, F1Fo-ATPase synthase f subunit

Gene Symbol

ATP5MF

Additional ATP5J2 Products

Product Documents for ATP5J2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP5J2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.